Protein Info for MIT1002_00304 in Alteromonas macleodii MIT1002

Annotation: SNARE associated Golgi protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details amino acids 24 to 28 (5 residues), see Phobius details transmembrane" amino acids 23 to 23 (1 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details PF09335: SNARE_assoc" amino acids 63 to 178 (116 residues), 63.5 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: None (inferred from 94% identity to amc:MADE_00383)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MIT1002_00304 SNARE associated Golgi protein (Alteromonas macleodii MIT1002)
MNSSLLRFFILVLTILFFSHLIPVSPSFDAFNQEWIDKHTRNNGVTGIAKFLAVSVFLLS
IGLPRQLVAFMGGYAFGFAAGIIYSTLAAILSCATVMAVSRSFARPIIIQHFEMRVRKLD
HFLVRSPFLKSVIIRLLPVGNNLLTNIFAGVSKIPRRSFILGSTIGYIPQMAVFALMGKG
VLVNSELKIIISALLFGISSLLSAYLFKVYRRQHNDDKTLRSLTKSSKCSNESDELSH