Protein Info for MIT1002_00303 in Alteromonas macleodii MIT1002

Annotation: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 78 to 110 (33 residues), see Phobius details amino acids 121 to 137 (17 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 200 (30 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF02366: PMT" amino acids 36 to 238 (203 residues), 52.9 bits, see alignment E=4e-18 PF13231: PMT_2" amino acids 71 to 235 (165 residues), 77.5 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_00382)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (580 amino acids)

>MIT1002_00303 Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (Alteromonas macleodii MIT1002)
MNQTSLAIKHKNKHPNYTFWLFVLASVLIFIGIGLRDPWPADEPRFAQVAKEMVETGQWF
FPARAEEFYPDKPPVFMWSIAFFFALFGSIKIAFLLPSALCSLLTLFLVYDISKRLWSTK
EALIATSLLLLSFQFLLQAKSAQIDAMVCCWITIGCYGLLRFFLVERRWRWYYLAFFFMG
IGVITKGVGFLPVLMLIPYLIHRRVWPQRDIAKKQTKNSVLPWIMGAVVMLLAISLWFIP
MLILVENSHDPSLALYRDNILFRQTVTRYADSWHHIKPFWYYLVEVIPLFWLPISIALPW
LIPFWYSAIKKGDARILLPLGWIVLVLLFFSVSPGKRGVYILPALPMLALISAPYFDSVV
NKKVFSWLLWGVVFLLSVGLLGFGFSGIVEASFALKLEEKFGLSPWMFFLVTGGLTCLVT
VITSRGKHWKAWPYFLCTLWGMYATWGYTLLEDVKTPKSVFGNIEKEIGKHDATIALVDF
SEQFILFSPYPIVHFGYHTPTDEQLSAAYQWMEKTDKGRYILVDEKHVRNDCFKKEMATS
VGYAHRVHWVLLSHEALTEKCPLTRTTTEIFSYIPDRPVT