Protein Info for MIT1002_00302 in Alteromonas macleodii MIT1002

Annotation: Phosphoethanolamine transferase EptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 73 (26 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details PF08019: EptA_B_N" amino acids 59 to 207 (149 residues), 118 bits, see alignment E=3.7e-38 PF00884: Sulfatase" amino acids 234 to 518 (285 residues), 229 bits, see alignment E=8.7e-72

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 66% identity to gag:Glaag_3264)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>MIT1002_00302 Phosphoethanolamine transferase EptA (Alteromonas macleodii MIT1002)
MKFPITLNFNPTSAQFILVSSLFIAAIFNAPFLSAVYEVVAPVTLNEWVFFLSVPLLLTF
FNVIFLSLFGALFLPRTTVAIAFVVSSLLLYGTLAYGVIFDKSMIQNVMETNSGEAFSYL
NSTLVLFFSILGLIPVFAIFNLELNGKLKARIKHLLVLNLLALLGIAIIATFLFKSYAAV
GRNNKDLTKYIIPYAFYDSGYKYLRDTYFYPPFPYKVLDKRPYIKGNADIHPSTTVFVVG
ETARADKFSSNGYSRRTTPNIQNAGAISFSKVTSCGTATAVSVPCMFSRLSRENYDSRIA
DSQDNVLDIIHRAGVDVTWIDNNSSCKGVCKRVETIDFNPSRVPKLCDGDYCYDEVLIDL
LRETLSRPSKEHRVIVLHMIGSHGPTYYRRYPEKFAKFVPDCPRSDIQNCEEAELTNTYD
NTIAYTDYVLGQIIEQLSTIPNSSMLYLSDHGESLGEKGLYLHGFPYNLAPVEQTHVPMV
YWASKFSQPEYSDCVRSLSSHPYSHDNLFDTLLGLTNVQSSTYQPTQDILRKCES