Protein Info for MIT1002_00268 in Alteromonas macleodii MIT1002

Annotation: 1,2-phenylacetyl-CoA epoxidase, subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 214 to 234 (21 residues), see Phobius details PF00970: FAD_binding_6" amino acids 304 to 402 (99 residues), 50 bits, see alignment E=6.2e-17 PF00175: NAD_binding_1" amino acids 413 to 519 (107 residues), 65.7 bits, see alignment E=1.1e-21 PF00111: Fer2" amino acids 568 to 637 (70 residues), 56.3 bits, see alignment E=5.2e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to amc:MADE_00340)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (644 amino acids)

>MIT1002_00268 1,2-phenylacetyl-CoA epoxidase, subunit E (Alteromonas macleodii MIT1002)
MSMWWPHTSFFLRYAVILNVMLLFATTSSYAQQQPEDSEHASHHPEATNDPTVNANTDVL
PTATQGKGPLGNADAMMGSGMAKGMDKMMEKMGAPKPKDLYPTLMRMHSATPEQRETVLI
KATARMQQGSEQLATGFDWLARAAATDDYSQMQMAVETVKEGIAHFDSGLAAKRAIQDGQ
EPRRVALTWFKSQMNLLPSAPEKGTSTLFGMTPFHSAVMLVLLIFTIVMVYVYGFKMRRA
AALLEELKSTDTASTSAPTTKVSSVVESNPAAQQHASAPAQSSEPALSSTASSRKGTFSG
GMVVTAIFNETHDVKTLRLASPDGQTIPFDFEPGQFVTFTLNIDGFEKPVKRSYTIASSP
TEQYYFEVTIKREEFGVVSRYMHDAVEVGNTLSIKAPGGKFYFNGHGSNSVVLISGGVGI
TPMMSAVRYLTTTCWDGDIYFLFCTRTSNDFIFEQELKYLQARHPRLKVLVSMTQAEGTS
WMGPQGRFSSAMINEFVPDIASKTAHICGPPAMMDATKKMLAELGMPNTHIKTEAFGAAK
PEPAPVKPQLATNTNAGDNRQVRFSLSDVEAHAGPDETVLDVADGLDVDIENSCRAGSCG
SCKVKLLRGDVDMEVDDGLEPEDKLSGYILACQAIPKSDVEVEA