Protein Info for MIT1002_00258 in Alteromonas macleodii MIT1002

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 1 to 198 (198 residues), 162.3 bits, see alignment E=6.5e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to amc:MADE_00327)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>MIT1002_00258 putative membrane protein (Alteromonas macleodii MIT1002)
MVVFHFAYDLRFFGWVDWNVPNGKGWREFRYVILTLFFVSVGASLVLGNYRKFSLKMFLL
RLFSIAFWAAVISLFTYYFFNANWIFFGVLHFIAVASVLCVPLIRKPILSLLLGFVAVTL
FNIGLVSSKWPFNLISLSLPHSPNDYVAIFPWIGVVLFGIAIGHVLKSGFDPFAKWNIPN
KLTLLGRHSLAVYILHQPIFFALFGTIYWFSSSV