Protein Info for MIT1002_00251 in Alteromonas macleodii MIT1002

Annotation: Cation efflux system protein CusB precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF19335: HMBD" amino acids 45 to 71 (27 residues), 33 bits, see alignment (E = 1.4e-11) TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 97 to 394 (298 residues), 132.7 bits, see alignment E=7.3e-43 PF25919: BSH_CusB" amino acids 126 to 240 (115 residues), 69.5 bits, see alignment E=5.1e-23 PF25869: 3HB_CusB" amino acids 160 to 208 (49 residues), 43.4 bits, see alignment 7.3e-15 PF25954: Beta-barrel_RND_2" amino acids 245 to 321 (77 residues), 83.9 bits, see alignment E=2.2e-27 PF25944: Beta-barrel_RND" amino acids 265 to 322 (58 residues), 31.8 bits, see alignment 4.8e-11 PF11604: CusF_Ec" amino acids 416 to 481 (66 residues), 67.5 bits, see alignment E=2.3e-22 amino acids 497 to 567 (71 residues), 64.2 bits, see alignment E=2.5e-21 amino acids 583 to 653 (71 residues), 80.6 bits, see alignment E=1.8e-26

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to amc:MADE_00319)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>MIT1002_00251 Cation efflux system protein CusB precursor (Alteromonas macleodii MIT1002)
MSTIKALVIGGVAGGIMTALAFTFLIPSSSSTANNEQNEEKQPLYWVAPMDPNYRRDEPG
KSPMGMDLIPVYEESSSGDAGSGTITIAPNVENNLGVRTAKVQRRALHVPIRTVGYVQYN
EETLIHVHPRVEGWIETLHVKASGEYVKKGEPLYSLYSPELVNAQEELLLAMRRNNKDLI
VAARSRLNALQVPEDVVETLTKTKNVQQTVTFSAPQTGFVDNLNIREGFFIKPGVTVMSI
GALDEVWVDAEVFERQTAQIVEGLPVTMTLDFLPGKTWQGVVDYVYPTLEQSTRTLRVRL
RFANQDYTLKPNMFAQVTIHSDMDSTNLIVPTEAVIRTGNQNRVVLALGDGKFKSVAIKI
GRVVDEFTEVLEGLIDGDSIVTSAQFMLDSESSISSDFKRMEPPEESLTSVFTEVMITDV
MPSHNMITAKHGPIPEWDWPPMTMDFVVAEHINLATVKGGSSAHIEISKQTDGQYVVTTV
HIIDSAQSTQATMSESVWTEVKINSVMDGHRMINVDHPAIKEWDWPAMTMDFNVADNITL
SDLASGTLAHIEISKSSSGEYLVSTIHVVEEASSETSTAVDAVWTQATVNAVMSASNQLS
LEHDPIEAWDWPAMTMDFNVANEVDLSDITAGMRLHIEITKTQDGAYVITTVHIQASDKG
TMDNSQHEGAHE