Protein Info for MIT1002_00234 in Alteromonas macleodii MIT1002

Annotation: Sensor protein ZraS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF02518: HATPase_c" amino acids 434 to 541 (108 residues), 78 bits, see alignment E=3.7e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to amc:MADE_00277)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>MIT1002_00234 Sensor protein ZraS (Alteromonas macleodii MIT1002)
MTDKVVKLTIKSLFIWVVMSITTFSLAVLSSLAVYTQIKTYRHELESNALMLAKLVASSS
AMYLYDETPERIELALSNLAAADHVLNAHVYKAQSGNLEPQIFASYNKEGQLLLGGKENQ
LASMFMTPQLADNGQYLELSAKVFDTETNIQLGWIYLRISSENFNQLVGKSIWLNLAVAL
ALLAISFYFAVRMQRIVTGPVEDIANFLQRTSRQRDYSARASGSTIRELDILADAVNVML
FRMQEYMQKQRQAEEQHRKLNASLEDMVSHRTTALKDANQELIQTLEKLHQFQRQIVQNE
KMASLGDMVAGVAHEVNTPIGLGVTASTMMLDRLAVIQKDFENKTLKASAMKRFLDESNE
NLNIIYRNLNRAAELISSFKQVAVDQTSESSRSFCVVQLVNEILLSLQPRLKKLKHNINV
DCDPTLSVETKAGPINQILINLIMNSVIHGFETMDEGTIDIRAEMVSSNKLKLVYTDNGK
GISPEIRKRIFDPFVTTKRGQGGSGLGMHLVYNLVTQALNGSISITSEEGNGVEFVIIFP
VVNAKTSE