Protein Info for MIT1002_00230 in Alteromonas macleodii MIT1002

Annotation: peptidase PmbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF01523: PmbA_TldD_1st" amino acids 29 to 93 (65 residues), 45.3 bits, see alignment E=1.2e-15 PF19290: PmbA_TldD_2nd" amino acids 120 to 227 (108 residues), 60.1 bits, see alignment E=4.4e-20 PF19289: PmbA_TldD_3rd" amino acids 235 to 442 (208 residues), 226.9 bits, see alignment E=2.7e-71

Best Hits

Swiss-Prot: 55% identical to PMBA_ECO57: Metalloprotease PmbA (pmbA) from Escherichia coli O157:H7

KEGG orthology group: K03592, PmbA protein (inferred from 97% identity to amc:MADE_00273)

MetaCyc: 55% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>MIT1002_00230 peptidase PmbA (Alteromonas macleodii MIT1002)
MQIEQQLADIQNVVDDVLKLALSKGATQAEASMSKVQGIAVSSRMQEVENVEFTNDGGLG
ISVYVGKRKGSASTADLSKAALTLAVEKAVDIARYTSEDPCTGLADADLIATEFPDLDLY
HPEELDTEKAIKTAIEAETAAMNYDSRITNSDGASYNANLGMRVYGNTHGINAGYPSSRY
SLSCMVIGAQDNDMQRDYAYTVSRKASLLQSASAVGIEAAKATVDRLGARKINTANVPVL
LHRDIASSLFGHYVGAISGGSLYRRSSFLLDSLGKQVFPEWLNIEERPFIKGGLASSSFD
NEGVACSDMTIVDAGKLATYLYTTYSSRKLNTRSNGHAGGIHNWLVGDTGHSDADLLKEM
GTGLFVTELMGQGVNGVTGDYSRGAAGYWVENGIIQYPVHEVTIAGNLKDMFKGIVAIGA
EKDVRGSVQTGSVLIDQMKIAGS