Protein Info for MIT1002_00223 in Alteromonas macleodii MIT1002

Annotation: Maf-like protein YhdE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR00172: septum formation protein Maf" amino acids 1 to 189 (189 residues), 171.2 bits, see alignment E=8.3e-55 PF02545: Maf" amino acids 5 to 191 (187 residues), 203.8 bits, see alignment E=9.8e-65

Best Hits

Swiss-Prot: 50% identical to NTPPA_COLP3: dTTP/UTP pyrophosphatase (CPS_4557) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K06287, septum formation protein (inferred from 84% identity to amc:MADE_00267)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>MIT1002_00223 Maf-like protein YhdE (Alteromonas macleodii MIT1002)
MKKSVVLASASPRRTALLKQMNIAHTIQPADIDESPRDNEPPMELVARLASEKAQAVKAY
LEDQQAMTDDKVILASDTLISFNGQSVGKPEDKADSKRILTMLSGKTHDVLTAICVLDKA
QQQTQVITTSVTFAALTDEQIDAYWETGEPADKAGSYAIQGIGGEFVVSINGSASAVIGL
PLYETRQLLNAFGLNEFGVVS