Protein Info for MIT1002_00195 in Alteromonas macleodii MIT1002

Annotation: putative symporter YidK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 40 to 425 (386 residues), 197.6 bits, see alignment E=1.9e-62 PF00474: SSF" amino acids 40 to 425 (386 residues), 110.8 bits, see alignment E=3.9e-36

Best Hits

KEGG orthology group: None (inferred from 87% identity to alt:ambt_17275)

Predicted SEED Role

"Predicted sodium-dependent galactose transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>MIT1002_00195 putative symporter YidK (Alteromonas macleodii MIT1002)
MSGSLTQLVVFIFITALIGLLTYLKCRGHGHSKANENKEYFLAGGGLTWIYVAGSITLTN
LSTDQLVGMNGNQMALLAWWEFAAVAGLIILARVFLPVYYHYQCTTTTELLEMRYNNKHI
RALIGLLFFLGSSLIFMPAVIYTGSLFMINMFNVDIPLMYVATAFALIGAFYAIFGGLRA
VAVSDTYSGVLLLTMAIVVVVLALFAIDFDFSGIPAERLTLIGDNDSPLPWHTLLTGMVF
IQTFYWSTNQVITQRAMAAPNLKEAQKGVYAAAIIRFIVVPTIIVVPGIISYKLYGDIND
AAYGTLVGDVLPSWLSGVFAAALAAAVLTTYNSNLNSATALYVCDIHEAYFQKKPSVARL
SGFVTAALTIVSLVMVPVYAQAESIINLLQQLFGLLSMPILSIFIVGLLFNNVNANAGIA
AVVFGVGLYAFFSFVHAPFGLHYIHLMLVTLVCCIALALVLNRVVFKQKAEWRGRLIESE
EAHG