Protein Info for MIT1002_00188 in Alteromonas macleodii MIT1002

Annotation: Galactose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00209: galactose-1-phosphate uridylyltransferase" amino acids 3 to 346 (344 residues), 538.3 bits, see alignment E=3.7e-166 PF01087: GalP_UDP_transf" amino acids 5 to 176 (172 residues), 235.2 bits, see alignment E=7.9e-74 PF02744: GalP_UDP_tr_C" amino acids 185 to 346 (162 residues), 222 bits, see alignment E=3.8e-70

Best Hits

Swiss-Prot: 60% identical to GAL7_SALTY: Galactose-1-phosphate uridylyltransferase (galT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00965, UDPglucose--hexose-1-phosphate uridylyltransferase [EC: 2.7.7.12] (inferred from 86% identity to alt:ambt_17375)

MetaCyc: 59% identical to galactose-1-phosphate uridylyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-glucose--hexose-1-phosphate uridylyltransferase. [EC: 2.7.7.12]

Predicted SEED Role

"Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.7.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.10 or 2.7.7.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>MIT1002_00188 Galactose-1-phosphate uridylyltransferase (Alteromonas macleodii MIT1002)
MGTPFDPTNDPHRRYNPLLGEWVLVSPHRAKRPWQGASEEPNNEQKPSYDSTCYLCPTNT
RVNGEVNPDYKGTFVFQNDFAALKQDTEQASEKKGLFQFETEQGCSRVICFSPDHSKTLP
ELSDEERVDVVNTWKAQTAELGETYRWVQVFENKGSMMGCSNPHPHGQVWAQQHVPTDPA
KKVVQLQQYFGDNGTPMLLDYAEQEVAKQERVVCKNDDWVVVVPYWAAWPFETLLLPRFD
VQSMHMLSDSQSLSLAKIIGEITAKYDNLFETSFPYSMGWHSAPFDSEAHPEWTLHAHFF
PPLLRSASVRKFMVGYEMMAEAQRDLTPEQAADRLKALSAVHYKKRENANG