Protein Info for MIT1002_00186 in Alteromonas macleodii MIT1002

Annotation: Mgl repressor and galactose ultrainduction factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00356: LacI" amino acids 3 to 48 (46 residues), 74 bits, see alignment 1.3e-24 PF00532: Peripla_BP_1" amino acids 60 to 275 (216 residues), 82.1 bits, see alignment E=1e-26 PF13407: Peripla_BP_4" amino acids 63 to 309 (247 residues), 48.6 bits, see alignment E=1.7e-16 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 98.1 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 44% identical to GALR_SALTS: HTH-type transcriptional regulator galR (galR) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 96% identity to amc:MADE_00229)

Predicted SEED Role

"Galactose operon repressor, GalR-LacI family of transcriptional regulators" in subsystem Lactose and Galactose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>MIT1002_00186 Mgl repressor and galactose ultrainduction factor (Alteromonas macleodii MIT1002)
MATIKDIAQAAGVSLATVSRVINNGPKVGNDTRKRVKKIMEEMGYRPNANARALVTKRSA
SLGVVIAELHDPFFAMLAHGVESITRKNNVQILLSAGSIEKETELRAIETLLEHRVEAMV
VHSKALDDETLIGFANQVPGFVLINRYIPEIANRCVWLDNVTGGRLMAEYAINQGHEHVA
VISSQYRIDDPNHRLEGIRNAVNNANLSLPESMIEYATPDQEGGELAMQNLLATGAKFTA
VLAYNDAMASGAMTMLQDHGISVPEQVSVMGYDDVLLAKYCRPKLTTLRYPVEMMAAKAA
ELALKYASGSKPEDGLTFKYTPTVVKRDSMVRV