Protein Info for MIT1002_00180 in Alteromonas macleodii MIT1002

Annotation: Inner membrane transport protein YajR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 10 to 34 (25 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 75 to 91 (17 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 347 (336 residues), 149.8 bits, see alignment E=9.9e-48 amino acids 214 to 379 (166 residues), 39.1 bits, see alignment E=4.7e-14 PF00083: Sugar_tr" amino acids 42 to 177 (136 residues), 27.4 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_00225)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>MIT1002_00180 Inner membrane transport protein YajR (Alteromonas macleodii MIT1002)
MNVLELRAALALASVYVLRMMGLFMVMPVLAVAAMDYPDYSPLLVGLAVGGYGLTQAALQ
IPMGMMSDKWGRKPVILLGLAVFALGSFVAANADSMAMMIVGRILQGAGAIAGAIMALAT
DVSRESQRAKVLAIIGIAIGFSFYLAVILGPLIANSYGLAGVFGITGILAILCMPLVKWV
VPNGVQLSSGDTLPQKDQLKRLVFSSQLWRLNISVMILHMMITLLFVQLPVTLLNFDMTL
DSHWTVYLPVLGASIVGLIIMMGAARGRTPKSLLVTGVVFMGGAFLALSLEDHSWWWVTA
AVVLFFTGFNYLEANFPALVSSIAPAGQKGTAMGLYASFQFFGAFLGGVISGFVTDIWSQ
ELAYGIGAASTLLWLFIILGVKEVSRVKRVMMNGDFDSSNVSSIEAELLLVPGVLEVTLN
SQNNAVYLKVDRDFDAVKARDVLSA