Protein Info for MIT1002_00167 in Alteromonas macleodii MIT1002
Annotation: putative aromatic acid decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 68% identical to UBIX_VIBCH: Flavin prenyltransferase UbiX (ubiX) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 96% identity to amc:MADE_00212)MetaCyc: 61% identical to flavin prenyltransferase (Pseudomonas aeruginosa)
RXN-16937 [EC: 2.5.1.129]
Predicted SEED Role
"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)
MetaCyc Pathways
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
- prenylated FMNH2 biosynthesis (2/3 steps found)
- superpathway of chorismate metabolism (42/59 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Ascorbate and aldarate metabolism
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Fluorene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Purine metabolism
- Pyruvate metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.-
Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (210 amino acids)
>MIT1002_00167 putative aromatic acid decarboxylase (Alteromonas macleodii MIT1002) MKHDKQVTLAITGASGAPYALTLLKSLVNADYQVYVLISSAAKVVFATEENVKIPGRPED AAAFFAEHCNAKPDQIKVFGKEEWFSPVASGSAAPAKMVVCPCSTGTLSAISIGASDNLI ERAADVVLKERGQLILVPREMPLSSIHLENMLKLSQMGATIMPAAPGFYHNPKTIDDLVD FVVARILDHLGIEQSLVARWGYQSSKHSED