Protein Info for MIT1002_00159 in Alteromonas macleodii MIT1002

Annotation: Diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00652: diaminopimelate epimerase" amino acids 4 to 274 (271 residues), 327.4 bits, see alignment E=3.5e-102 PF01678: DAP_epimerase" amino acids 5 to 125 (121 residues), 120.5 bits, see alignment E=4.5e-39 amino acids 155 to 269 (115 residues), 119 bits, see alignment E=1.3e-38 PF02567: PhzC-PhzF" amino acids 12 to 239 (228 residues), 32.4 bits, see alignment E=7.3e-12

Best Hits

Swiss-Prot: 78% identical to DAPF_PSEA6: Diaminopimelate epimerase (dapF) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 98% identity to amc:MADE_00205)

MetaCyc: 68% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>MIT1002_00159 Diaminopimelate epimerase (Alteromonas macleodii MIT1002)
MQVQFSKMHGLGNDFMVIDNVTQNVFFSKEKIQQLANRNFGIGFDQLLMVEPPYDPEQDF
HYRIFNADGSEVEQCGNGARCFARFVKQKGLINRNKIIVSTKAGKMVLYLEKDGQVTVNM
GKPEFEPANIPLKANKQENTYILRVGESTLFIGSASMGNPHCVMEVDDVDTANVAEIGPL
VEKHERFPEGVNVGFMQIINESHIKLRVFERGSGETLACGSGACAAVAIGQIQGKLGKDV
RVDLPGGSLRIRWPGPDNVLKMTGPAEHVYDGHINL