Protein Info for MIT1002_00155 in Alteromonas macleodii MIT1002

Annotation: Diguanylate cyclase DosC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 75 to 103 (29 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details PF05231: MASE1" amino acids 49 to 305 (257 residues), 33.4 bits, see alignment E=2.7e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 345 to 500 (156 residues), 130.3 bits, see alignment E=2.9e-42 PF00990: GGDEF" amino acids 347 to 497 (151 residues), 124.8 bits, see alignment E=2.8e-40

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>MIT1002_00155 Diguanylate cyclase DosC (Alteromonas macleodii MIT1002)
MEKPAISKSRSQQASKVDKPTSNVHEHAETGRSFWPFKPLSGLYQDIFIILSWIAIWQIG
RIVEYTEHASVWFPAAGYTLACFLVLGWRAVVPIMVAAIAITVWNGHNYLLPLSNVEMMW
GGVLFGVAHMLPYYAGASVLGHLLRKPDVTTPQLIVSFLIIGCISSLVATQLVIGSLVLT
NQMSAADIKEAMLPFWIGDMAGVVVLAPLCAGLLVKISAASKIDLLAFSNCASSDLHSYF
KKVAVNLALILFVMLLAKLTQSRDSAFAIFFLAITHMWIACTESTKRNVISLAISSLSIV
LLVHIFALMDYVKVYQFALNVIAANALFGIAIPQLQADNALLKDRVFVDTLTQAYTREYL
AQRSALEMAQSRESGSSLYFVMFDLDKFKRINDELGHVDGDNALRRLSQVTKDIVRKADV
FARFGGDEFVLLLPNISEQNALNLVEKVREGINAIVISEVSLSSSFGVTLMQQSDTLETL
IQRADRALYASKEKGGNTITLK