Protein Info for MIT1002_00150 in Alteromonas macleodii MIT1002

Annotation: Magnesium transporter MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 282 to 302 (21 residues), see Phobius details amino acids 309 to 335 (27 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 384 to 409 (26 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details PF03448: MgtE_N" amino acids 35 to 132 (98 residues), 67 bits, see alignment E=1.9e-22 PF01769: MgtE" amino acids 316 to 439 (124 residues), 117.7 bits, see alignment E=3.9e-38

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 97% identity to amc:MADE_00197)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>MIT1002_00150 Magnesium transporter MgtE (Alteromonas macleodii MIT1002)
MAEPLPDLIEEIVTESMGDDPATLLATLAGQDEVYIASLLESLPVEKRLAVWEGIPRDRK
LDVLVEMRSDPREILIDNTPHDEWASIFADIDAEDLLELLDSLPKRLVDMAYESLDSKER
KYFREATQFPDNQIGHWVNHEQLVLPSNAKVREGLRLLRRDIPQHCDSIFLVNRSGQFSA
LVKISHLFNAQDHVSLFDLSEESVTTIQGADDTMNASLLVQRSGLASLPVVDENNKLLGR
LDVTSASELVNEFYERQVMASAGMDEDEDLFSPVAKSAKNRALWLGINLLTAFLASWFIG
LFEGTLQQVVALAVLMPVVASMGGIAGSQTLTLIVRGLALGQVTPANLRALMVKELKVGG
VNGVIWALVIGVVAYFWFTDAMLGLVICLAILFNIVAAALAGVFVPVILDKLKIDPALSG
SVILTTVTDIVGFVAFLGLGTLFLL