Protein Info for MIT1002_00144 in Alteromonas macleodii MIT1002

Annotation: GTP cyclohydrolase-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00505: GTP cyclohydrolase II" amino acids 11 to 197 (187 residues), 250.1 bits, see alignment E=5.9e-79 PF00925: GTP_cyclohydro2" amino acids 12 to 173 (162 residues), 211.5 bits, see alignment E=2.9e-67

Best Hits

Swiss-Prot: 63% identical to RIBA_COLP3: GTP cyclohydrolase-2 (ribA) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 99% identity to amc:MADE_00192)

MetaCyc: 58% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>MIT1002_00144 GTP cyclohydrolase-2 (Alteromonas macleodii MIT1002)
MSSKQPKYEYVSTAKLPTRMGDFKIHGFVEASGQEHVALSYGEWKEDDVVPIRIHSECLT
GDSLFSTRCDCGFQLEKAMQNIVDNGHGVLLYLRQEGRGIGLLNKIRAYNLQDSGMDTVE
ANEHLGFDADLRSYDICKLMLDTLSVKHVELMTNNPKKLAALKALGIDVVARKPIDHGIT
KDNKHYLKTKTEKLGHAFDPHVFK