Protein Info for MIT1002_00135 in Alteromonas macleodii MIT1002

Annotation: Multidrug-efflux transporter MexB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1032 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 339 to 358 (20 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 437 to 459 (23 residues), see Phobius details amino acids 470 to 496 (27 residues), see Phobius details amino acids 539 to 560 (22 residues), see Phobius details amino acids 869 to 887 (19 residues), see Phobius details amino acids 894 to 914 (21 residues), see Phobius details amino acids 920 to 941 (22 residues), see Phobius details amino acids 969 to 991 (23 residues), see Phobius details amino acids 997 to 1023 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1023 (1023 residues), 1272.2 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1030 (1030 residues), 1637.1 bits, see alignment E=0 PF03176: MMPL" amino acids 293 to 512 (220 residues), 37.5 bits, see alignment E=2.1e-13 amino acids 820 to 1023 (204 residues), 28.2 bits, see alignment E=1.4e-10 PF02355: SecD_SecF_C" amino acids 333 to 496 (164 residues), 21.5 bits, see alignment E=2e-08

Best Hits

Swiss-Prot: 60% identical to MEXB_PSEAE: Multidrug resistance protein MexB (mexB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 97% identity to amc:MADE_00183)

MetaCyc: 57% identical to multidrug efflux pump RND permease MdtF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-359; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1032 amino acids)

>MIT1002_00135 Multidrug-efflux transporter MexB (Alteromonas macleodii MIT1002)
MARFFIDRPVFAWVLAIITMMAGVLAITSLPIEQYPKVAPPSVTISATYPGASAETVENS
VTQVIEQSLTGIDNLRYFSASSSNSSMSITLTFEPGADPDIAQVQTQNKVQGALPLLPTQ
VQQQGVTVTKANSAFALAVGFYSEDDSMTQYDLSDLLVSQFRDPISRVNGVGNVRVFGAQ
RSMRIWLDPDKLYSYNLTPTDVQGAVQVQNTDVSAGQLGGMPAIENQQINATIQAQSRLQ
TVEDFENIVLRVNTDGSQVRVRDVARVELGAQSYDVIVRYDRKPASGMAISLASGANALD
TIKAVKARVEELRSNLPDTVKVVYPVDSSPFIELSIESVVHTLIEAVVLVFLVMLLFLQN
WRATLIPTIAVPVVLLGTFAVLLAFGFSINVLTMFAMVLAIGLLVDDAIVVVENVERIME
EEGLSPAEATKKSMTQITGALVGIAAVLSTVFIPMAFFSGSAGAIYRQFSVTIVSAMAFS
VLVAIILSPSLCATLLKKHPENHDKNKGFFGWFNRTFNKGRDRYQKTTTHMAQRFKRYFV
VYGLLVGGMAFIFSQLPGAFLPDEDQGRMMVLVSTPPGATAGRTLESIKQVEDYILEQEQ
DAVNGMFAVVGFSFAGQAQNAGMAFLNFNDWSVRDENNSAFAVMNRAFGAFSQIQDASAF
PIVPPPIMELGNATGFDMQLVDRGGNGHEALMNARNQLLGMAAQNPKLAGVRPNGLSDVP
QFKINIDSEKASALGLNLSEINNALQIAWGSSYVNDFIDKGRIKRVYMQADLPHRMTPED
LDKWFVRNSEGEMVAFNTFSTTEWVYGSPKLERFNGVSSVNIQGSAAEGISSGEAMAEMQ
KLVEQLPPGFAIEWSGLSYEEQEAGSQAPMLYALSILIVFLCLAALYESWSVPFAVMLVV
PLGILGSVTAAFIFNLPNDVYLQVAFLTTVGLAAKNAILIVEFAKEQYENGEDLMTAVSN
AASQRFRPILMTSMAFILGVTPLALASGAGAASQNAIGIAVMGGMFAATFLAIFFVPMFY
VLVEKLFHREDK