Protein Info for MIT1002_00131 in Alteromonas macleodii MIT1002

Annotation: Quaternary ammonium compound-resistance protein SugE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 94 (94 residues), 83.4 bits, see alignment E=6.9e-28

Best Hits

Swiss-Prot: 49% identical to GDX_YERPS: Guanidinium exporter (gdx) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 95% identity to amc:MADE_00178)

MetaCyc: 45% identical to guanidinium exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-368; TRANS-RXN-369

Predicted SEED Role

"Quaternary ammonium compound-resistance protein SugE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>MIT1002_00131 Quaternary ammonium compound-resistance protein SugE (Alteromonas macleodii MIT1002)
MSWIYLIVAGLLEIGWPVGLKMSQEAETRVMGILLAVGFMTASGFCLWMAQKQIPIGTAY
AVWTGIGAAGTFLVGVMFYGDPSSLARYFGVALIVAGVVVLKLAH