Protein Info for MIT1002_00129 in Alteromonas macleodii MIT1002

Annotation: OriC replication inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR03298: transcriptional regulator, ArgP family" amino acids 2 to 292 (291 residues), 284.8 bits, see alignment E=3.3e-89 PF00126: HTH_1" amino acids 5 to 61 (57 residues), 57.1 bits, see alignment E=1.4e-19 PF03466: LysR_substrate" amino acids 90 to 281 (192 residues), 40.8 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 92% identity to amc:MADE_00176)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>MIT1002_00129 OriC replication inhibitor (Alteromonas macleodii MIT1002)
MLDYDALRCFHEVLRYGGFEKGAQALNLTQSAVSQKIKRLEQSVGGPVMVRTKPLRATPL
GKELLAHIQKVSVLEEALNIQSGLEASAAPISVAVNNDVLATWFSQVMAAFSDKRANPIH
IVNADQTQTRDILQQGRVMACISQTGTPVTGGQSIRLGTMRYQLYASPRFIERYLHKEIS
PQSVMSTPGLLYDEYDVTLLTDYQRECLNIAPSFTTCHWYPSSHGFVKMALDGVVWALLP
TLQVEQEVNEGDLVPLFPQKELGVPLFWHWTTLESAALADLTKAVKNIAKAQLK