Protein Info for MIT1002_00103 in Alteromonas macleodii MIT1002

Annotation: Stalked cell differentiation-controlling protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 192 to 352 (161 residues), 164.3 bits, see alignment E=1e-52 PF00990: GGDEF" amino acids 194 to 350 (157 residues), 151.2 bits, see alignment E=2.2e-48 PF22335: Cas10-Cmr2_palm2" amino acids 269 to 351 (83 residues), 27.2 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: None (inferred from 82% identity to amc:MADE_00151)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>MIT1002_00103 Stalked cell differentiation-controlling protein (Alteromonas macleodii MIT1002)
MDSSSLRQLLRSAQQDEAEAKRRRLTLYFISYVGGTIMAFMAWINMGTNNPLLVGTLAGS
AAFVYANVALSHMFPRVDVFYYLAGLVVAFTINGLVYTGGLNNTGLYFIFPLLFIQIVVV
RFKPAMVYVAVTMGIAIFMLYNQEKIVAEYPAEHVSRFLIATFCFICVAFIGENFWHQSR
KEMLRENLERMRQANTDPLTKLPNRRFLEAVFFERAMQDPGAHFPLSAVVVDIDHFKTIN
DTYGHDIGDEVLIHITRLMKEAVRTTDVVARTGGEEFLVLFPHATLSQAVKLAEKMRKVV
EANPFVEGDVNHSITASFGVATALTDTNLHACLKQADDNLYKAKNAGRNRVVE