Protein Info for MIT1002_00093 in Alteromonas macleodii MIT1002

Annotation: Thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05690: ThiG
  • amino acids 4 to 247 (244 residues), 358.1 bits, E=2.3e-111

Best Hits

Swiss-Prot: 87% identical to THIG_ALTMD: Thiazole synthase (thiG) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 87% identity to amc:MADE_00142)

MetaCyc: 68% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Protein Sequence (256 amino acids)

>MIT1002_00093 Thiazole synthase (Alteromonas macleodii MIT1002)
MLTLANHTFPSRLLTGTGKFSNPDTMESAVQAAKSSMVTLAMKRVASHSSQDETLSALKA
LGVTLLPNTSGAKNAKEAIFAAELAYEALGSPWVKLEIHPDQRYLLPDPIETLLAAEALV
KKGFHVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLQTKPFLQIIVEQASIPVIV
DAGIGKPSEAMAAMELGVDAVLVNTAIATAKDPVAMAAAFASAVETGRKAFEAGLGATSS
FAQASSPLTAFLEPAV