Protein Info for MIT1002_00092 in Alteromonas macleodii MIT1002

Annotation: 2-iminoacetate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR02351: thiazole biosynthesis protein ThiH" amino acids 4 to 371 (368 residues), 509.7 bits, see alignment E=2.1e-157 PF04055: Radical_SAM" amino acids 80 to 234 (155 residues), 60.6 bits, see alignment E=2.2e-20 PF06968: BATS" amino acids 257 to 364 (108 residues), 55.2 bits, see alignment E=6.7e-19

Best Hits

Swiss-Prot: 57% identical to THIH_ECOLI: 2-iminoacetate synthase (thiH) from Escherichia coli (strain K12)

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 90% identity to amc:MADE_00141)

MetaCyc: 57% identical to 2-iminoacetate synthase (Escherichia coli K-12 substr. MG1655)
RXN-11319 [EC: 4.1.99.19]

Predicted SEED Role

"2-iminoacetate synthase (ThiH) (EC 4.1.99.19)" (EC 4.1.99.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>MIT1002_00092 2-iminoacetate synthase (Alteromonas macleodii MIT1002)
MKVAQALMQQDLSHVAMSINSKTAGDVERALGKDTLSLDDFMALISPAGAKYLEAMAYRA
KAITRHRFGNTMQLFVPLYLSNLCANECTYCGFTMSNKIKRKTLSISEVLTEIEAIKDLG
FSQVLLVTGEHETKVGMEYFEQTLSAIREKVSYLMMEVQPLKREQYETLKHLGLDAVLVY
QETYSPQHYANYHTRGKKQDFLWRLEASDRIGKAGIDKIGIGALLGLGDWRVDSAMTALH
GKLIQQHYWQSRVSIAFPRLRSCEGNSTGGDALTNSKLPNERDLLQLICAHRIFNPQAEL
SLSTRESAVFRDGVMPLGITSMSAASQTQPGGYSAPSKALNQFDIDDNRSVSDVVSALSM
KGLEPVWKDWMPFTERV