Protein Info for MIT1002_00069 in Alteromonas macleodii MIT1002

Annotation: 4-hydroxybenzoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 5 to 282 (278 residues), 337.4 bits, see alignment E=3.8e-105 PF01040: UbiA" amino acids 23 to 264 (242 residues), 233.4 bits, see alignment E=1.3e-73

Best Hits

Swiss-Prot: 65% identical to UBIA_PSEA6: 4-hydroxybenzoate octaprenyltransferase (ubiA) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 91% identity to amc:MADE_00072)

MetaCyc: 60% identical to 4-hydroxybenzoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
4-hydroxybenzoate nonaprenyltransferase. [EC: 2.5.1.39]

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>MIT1002_00069 4-hydroxybenzoate octaprenyltransferase (Alteromonas macleodii MIT1002)
MKHNWNAYARLMRLDKPVGIYLLLWPTLWALLMAAQGLPPLGITLIFVAGVVVMRSAGCV
INDYADRKVDGSVKRTAQRPLATGEVSAKQALQLFGALIALAFVLVLFLNWQTIALSVVA
LLLAASYPFMKRYTNLPQVVLGAAFGWAIPMAFMAVIETVPAYGWWLFIANLLWTVAYDT
MYAMVDRDDDLQIGIKSTAILFGKNDVLIVMLLQAAALAILWCIGCAINATWPYYLAVLF
SALLCVRQYQLIKRRQREGCFTAFIENHYIGLAITLGTALHFYLV