Protein Info for MIT1002_00068 in Alteromonas macleodii MIT1002

Annotation: Chorismate--pyruvate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF04345: Chor_lyase" amino acids 28 to 192 (165 residues), 114.4 bits, see alignment E=2.3e-37

Best Hits

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 86% identity to amc:MADE_00071)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>MIT1002_00068 Chorismate--pyruvate lyase (Alteromonas macleodii MIT1002)
MTCYHTNRFIIRAFRVSFNATFPVGLAVDWQAPSGITIPNAQLKNWLLDTGSLTERVQSL
SNHFSLELIGQHEQIPHDNELSFLLDNGETHYQAREILLCGDHKPWVFARSIIPQAFVDS
ELSNLGREPLGKRLFNDKRFTRSAFQLCTVPASQFGINSNQTLWGRRSLFTLGNYSMIVA
EVFLPPSPAYSHTAKNEKESEKQL