Protein Info for MIT1002_00066 in Alteromonas macleodii MIT1002

Annotation: Rhomboid protease GlpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 103 to 124 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details TIGR04239: rhomboid family protease GlpG" amino acids 5 to 278 (274 residues), 277.3 bits, see alignment E=8.2e-87 PF12122: Rhomboid_N" amino acids 5 to 76 (72 residues), 50.3 bits, see alignment E=2.4e-17 PF01694: Rhomboid" amino acids 139 to 279 (141 residues), 88.4 bits, see alignment E=5.4e-29

Best Hits

KEGG orthology group: K02441, GlpG protein (inferred from 88% identity to amc:MADE_00069)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MIT1002_00066 Rhomboid protease GlpG (Alteromonas macleodii MIT1002)
MAHPLIAFNQQSPAHLLANYLTSQHIQAAVIQHDKEFVVVLDNHDHLDRAKIIADGFLAN
PTDPKYQQAAWDNGKNVRLAPSGSGFSVGNIVADAVKAPFTSVVFILCVAVYLLSLFGLF
APIAQHLLMQPFSILSQNHEWWRLLGPAFIHFSALHIIFNLLWWGMLGAKIERILGMSML
LIVFLVSATISNAAQALFSDPVQGNLFLFGGLSGVVYAVMGFVWWLGWLRPSWGLSLPNS
IVGFMLVWLVLGYADILWVNMANAAHTAGLISGCLLAGALSLGSGRR