Protein Info for MIT1002_00062 in Alteromonas macleodii MIT1002

Annotation: Bacteriophytochrome cph2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 814 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 490 to 507 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 375 to 538 (164 residues), 147.2 bits, see alignment E=1.8e-47 PF00990: GGDEF" amino acids 379 to 533 (155 residues), 159.3 bits, see alignment E=7.2e-51 PF00563: EAL" amino acids 557 to 791 (235 residues), 251.1 bits, see alignment E=1e-78

Best Hits

KEGG orthology group: None (inferred from 86% identity to amc:MADE_00065)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (814 amino acids)

>MIT1002_00062 Bacteriophytochrome cph2 (Alteromonas macleodii MIT1002)
MKVQVSFTTKTITILLAMVLTVTVVISTVLIQESDARILLQQRENQVSNQRRVQLFEDIL
HGRMITLIDIISHKSGGNADSLESLQQTLSGLSEYLTLNFQVESLYLFDEHGVVGNPLQP
VNKTIEKLVNTTRASFESRSLLSCDSICTHYISIPIMANGETLPVIVVSTSMRELLYLFS
RATDVHKVAVVQHKETSSELSELRVASQVSAANRQYFQSLFDALPDNWRIDDLVIRGMNV
ALENQQLLVSLLPFNHASGDHPYLLIVQDVSAMVRQNEQYQYIVISSAVALFFIFSSLLY
LFLNQYRIRLLDVSERLPMLAEHKFSEFYTIAAKRRKSPIFKFTDELDVVEDAANNLARQ
LESFDGQMAINTAKLEKMAMFDVLTGLPNRNMLTFQIEKQLAGSIRDDRLVALMFMDLDD
FKKVNDSHGHDVGDKLLKAAAMRISKPIRESDIASRFGGDEFVILLSNIESKKHVDTVAK
KLIEEFKEPIIVDGVTFYVSISIGIAITNHSRATPVELLRHADIAMYEAKAKKGAEYRVY
DATMNLKVMQKVELESEAREALRDNQFSLALQPQLEMHTGRLVGFEALLRWQHPKKGNIS
PADFIPLLENTSFMLELDYWVITRSTYLIRELKNSGYSDVKMAINLSAGQFLDPSLPEFL
QQQIIKNDIAPDQVCLELTETVLVSDIKRATTIMQNIRDMGCMLAIDDFGTGYSSLSYLK
SLPADYIKIDRSFVANIASSADDRNIVHSTISMVRNMGMQVVAEGIETSEQYELLCHFDC
NLGQGYLISRPIPEVNIWDVLSDKVEFGFWKESA