Protein Info for MIT1002_00059 in Alteromonas macleodii MIT1002

Annotation: 3-deoxy-D-manno-octulosonic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF06293: Kdo" amino acids 32 to 235 (204 residues), 150.6 bits, see alignment E=6.4e-48

Best Hits

Swiss-Prot: 43% identical to KDKA_VIBCH: 3-deoxy-D-manno-octulosonic acid kinase (kdkA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11211, 3-deoxy-D-manno-octulosonic acid kinase [EC: 2.7.1.-] (inferred from 82% identity to amc:MADE_00060)

MetaCyc: 43% identical to 3-deoxy-D-manno-octulosonic acid kinase (Vibrio cholerae O1 biovar El Tor str. N16961)
RXN2G6Z-3 [EC: 2.7.1.166]

Predicted SEED Role

"3-deoxy-D-manno-octulosonic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.166

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>MIT1002_00059 3-deoxy-D-manno-octulosonic acid kinase (Alteromonas macleodii MIT1002)
MATIRRDIGAGHHFIFDDTLVSHPNAEMFTPDFWQLQDKITGQAKGRGTTIFIEHEGQRW
VLRHFKRGGLVGKVLSDQYLFIGVERSRPFEEFRLLEYMRAQGLLVPVPVAARIHRRGLI
YRGDLITLSIPNSKDLHHALCDKPLDKDEWYEVGRALAAMHNCQVYHHDANVRNIMIDSD
KQIWLIDFDRCEQRQGNSWKQGNLDRLLRSLHKEKAKNPVFHWQESDWSACMNGYREAVK