Protein Info for MIT1002_00058 in Alteromonas macleodii MIT1002

Annotation: Phosphopantetheine adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR00125: cytidyltransferase-like domain" amino acids 4 to 64 (61 residues), 72.9 bits, see alignment E=1.9e-24 TIGR01510: pantetheine-phosphate adenylyltransferase" amino acids 4 to 157 (154 residues), 196.2 bits, see alignment E=3.3e-62 PF01467: CTP_transf_like" amino acids 6 to 134 (129 residues), 114 bits, see alignment E=5.9e-37 PF08218: Citrate_ly_lig" amino acids 12 to 68 (57 residues), 31.4 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 98% identical to COAD_ALTMD: Phosphopantetheine adenylyltransferase (coaD) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 98% identity to amc:MADE_00059)

MetaCyc: 65% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>MIT1002_00058 Phosphopantetheine adenylyltransferase (Alteromonas macleodii MIT1002)
MHTRALYPGTFDPITNGHADLIERASQLFSHVIVAIASNPSKKPLFTLEERVEMIKKVTA
DLPNVEVVGFTGLLADFADEQNATILIRGLRAVSDFEYEFQLANMNRRLNPKLESVFLTP
AEENSFISSTLVKEVALHRGAVSGFCHPVVEKALKDRLSKKD