Protein Info for MIT1002_00046 in Alteromonas macleodii MIT1002

Annotation: Bacterial leucyl aminopeptidase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 PF04389: Peptidase_M28" amino acids 289 to 509 (221 residues), 152.3 bits, see alignment E=7e-49

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_00045)

Predicted SEED Role

"Gll4423 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>MIT1002_00046 Bacterial leucyl aminopeptidase precursor (Alteromonas macleodii MIT1002)
MTAMTFAATAHNHASTDNAFNPDTQRIKSHLFFLADDLLEGRDTGSRGHEIAALYIATEF
AKYGLKPAGTDGYMQNVAFRKANLVQESPKFTFTQNGETVEFDYPKEYLASPSLLSTEAN
VKGEMVFVGYGIVADELSHNDYKDLDVKGKVVVALAGKPSDFPSEEGAHFASGYQKQKYA
VDNGAIGMITITTPKNEKVRPYQSRLNYIHTPRMAWLDDSGQPANSFSQLKGGAYMSEGA
ARKLFEGAEKSLDDVYAQLEADKVPQGFALNGVVDISKTSVHDTITSPNVVGVLEGSDPE
LKNEYVVFSAHSDHIGFAKTVKKDNINNGAMDNASGTSVMLETARLFSEMEEKPKRSILF
VSVTGEEKGLLGADYFARNPTVPVTSMVANVNLDMPILTYEFADVIAFGANHSDLQESVE
KAAANANIELSPDPWPEQALFTRSDHYAFVKQGVPSVFMVPGLKSKDPNVDGSKVFGQFL
STHYHKPSDDINQPFNWNAAETFTKVNAQIGWTLANQKNKPKWNDGDFFGNTFSK