Protein Info for MIT1002_00036 in Alteromonas macleodii MIT1002

Annotation: Transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13384: HTH_23" amino acids 19 to 64 (46 residues), 41.2 bits, see alignment E=3.1e-14 PF06056: Terminase_5" amino acids 21 to 70 (50 residues), 22.1 bits, see alignment E=3.6e-08 PF13551: HTH_29" amino acids 22 to 75 (54 residues), 28.8 bits, see alignment E=3.1e-10 PF13518: HTH_28" amino acids 29 to 73 (45 residues), 29.3 bits, see alignment E=2.2e-10 PF13565: HTH_32" amino acids 49 to 126 (78 residues), 48.3 bits, see alignment E=3.7e-16 PF13592: HTH_33" amino acids 98 to 153 (56 residues), 51.8 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 54% identity to vha:VIBHAR_01035)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>MIT1002_00036 Transposase (Alteromonas macleodii MIT1002)
MHTADDFKQLAKQTSNGQLRTRYLALYLFKNGETRTQIATYLGVARGSVNTWVSNYLAHG
LEGLQSKPSPGRPCQLSVSQREQIAHFIKENAVKKEGGRLIAQDVRQYISDTFQIDYQLR
NVYRIMDALGFSWITSRSKHPKQSQQTQDTFKKFPAGNDPSHSRSSSSGSR