Protein Info for MIT1002_00025 in Alteromonas macleodii MIT1002

Annotation: t(6)A37 threonylcarbamoyladenosine biosynthesis protein RimN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01300: Sua5_yciO_yrdC
  • amino acids 28 to 200 (173 residues), 151.5 bits, E=8.8e-49

Best Hits

Swiss-Prot: 57% identical to TSAC_PSEA6: Threonylcarbamoyl-AMP synthase (tsaC) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K07566, putative translation factor (inferred from 94% identity to amc:MADE_00027)

MetaCyc: 53% identical to L-threonylcarbamoyladenylate synthase (Escherichia coli K-12 substr. MG1655)
RXN-14569 [EC: 2.7.7.87]

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.87

Protein Sequence (201 amino acids)

>MIT1002_00025 t(6)A37 threonylcarbamoyladenosine biosynthesis protein RimN (Alteromonas macleodii MIT1002)
MSDIQNGNVNTFTPVEANSPEVDPVVAAFQAGSLIVYPTEAVMGIGCDPDNEAAVNALLE
IKQRPVEKGVILIAANYSQLLPYVNDNAIRPDRRTDIFSSWPGPNTWLLPKSSSAPVWLT
GKHSKIAVRVTNHPVVVELCNKLGKPLVSTSANLTGQPPAITTEEAKAVFADSVFYIEGE
VGGATKPSTIRDGDTAEVIRA