Protein Info for MIT1002_00020 in Alteromonas macleodii MIT1002

Annotation: Peptide deformylase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR00079: peptide deformylase" amino acids 4 to 160 (157 residues), 196.1 bits, see alignment E=1.4e-62 PF01327: Pep_deformylase" amino acids 4 to 152 (149 residues), 178.8 bits, see alignment E=3e-57

Best Hits

Swiss-Prot: 99% identical to DEF_ALTMD: Peptide deformylase (def) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 99% identity to amc:MADE_00022)

MetaCyc: 64% identical to peptide deformylase (Escherichia coli K-12 substr. MG1655)
Peptide deformylase. [EC: 3.5.1.88]

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>MIT1002_00020 Peptide deformylase 1 (Alteromonas macleodii MIT1002)
MAILDVLSFPDERLRTVAKPVEEVNDEIKQLVSDMFETMKDENGIGLAATQVNRHVQVVV
MDVSEDQNEPRVFINPEIIRKDGSTISEEGCLSVPGNYAKVERAEAITVKALDQNGESFE
LDAEGLLAICIQHELDHLKGKLFIDYLSPLKRQRIRKKLEKEARLAAKA