Protein Info for MIT1002_00003 in Alteromonas macleodii MIT1002

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF13175: AAA_15" amino acids 1 to 117 (117 residues), 38.4 bits, see alignment E=2.8e-13 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 358 (358 residues), 319.1 bits, see alignment E=2e-99 PF13514: AAA_27" amino acids 1 to 93 (93 residues), 28 bits, see alignment E=3.9e-10 PF02463: SMC_N" amino acids 3 to 346 (344 residues), 107.7 bits, see alignment E=1.5e-34 PF13476: AAA_23" amino acids 5 to 121 (117 residues), 38.9 bits, see alignment E=4e-13 PF13304: AAA_21" amino acids 25 to 94 (70 residues), 29 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 56% identical to RECF_PSEA6: DNA replication and repair protein RecF (recF) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 98% identity to amc:MADE_00005)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>MIT1002_00003 DNA replication and repair protein RecF (Alteromonas macleodii MIT1002)
MKLDRVQITQFRNLTSVSLSPSPALTIIKGVNGSGKSSLIEALYYLGFGRSFRTNKHSSV
IQNEKDSFSVFASCKTEEGDELKLGFQRSRNETFTCSINGEHSNKLSDLVSLVPLQLFTP
QSTDLIIGSPSERRRFCDWGLFHVEHQFQSLANQYGKFLKHRNALLKQQANLSAPQNQYW
ESQFSELGESLSATRQEYVDILTPIFKQYAQEFLPNFDVELSYYKGWEKDVGLSESLVKK
REYDGKIGHTSSGPHKADLRLKVNGVNAQELLSRGQLRMAVAALQMSQTKLFNKATQRKS
IFLLDDVGAELDADKREQFIDGLLKMDTQVFVTAIESTQLAFIQKYNEKKMFHVEHGNVK
EE