Protein Info for MCAODC_28250 in Escherichia coli ECRC101

Name: pdeL
Annotation: Cyclic di-GMP phosphodiesterase PdeL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00196: GerE" amino acids 26 to 72 (47 residues), 30.6 bits, see alignment 2.1e-11 PF00563: EAL" amino acids 112 to 346 (235 residues), 207.6 bits, see alignment E=1.9e-65

Best Hits

Swiss-Prot: 93% identical to PDEL_ECOLI: Cyclic di-GMP phosphodiesterase PdeL (pdeL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eok:G2583_0420)

MetaCyc: 93% identical to DNA-binding transcriptional regulator/c-di-GMP phosphodiesterase PdeL (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"FIG00638331: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.52

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>MCAODC_28250 Cyclic di-GMP phosphodiesterase PdeL (Escherichia coli ECRC101)
MASHDLSVFLEEFGATVNLTLPGIVSEKERLLLKLLMEGMSVTEISQYRNRSAKTISHQK
KQLYEKLGIQSDITFWRDIFFQYHPQVISGTGNKNNFYIPDNRCHHIVTPEAISLALENH
EFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLAESSGLIVIMTRQLMKQT
ADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVKKLGNDKIKLVLELTERNPIP
VTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDFIKIDKSFVQMAGVDEISGH
IVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQGYLYSPPVPGNKFISEWVMKA
GG