Protein Info for MCAODC_27890 in Escherichia coli ECRC101

Name: ampH
Annotation: D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00144: Beta-lactamase" amino acids 46 to 358 (313 residues), 228.9 bits, see alignment E=4.9e-72

Best Hits

Swiss-Prot: 100% identical to AMPH_ECO57: D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH (ampH) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0376)

MetaCyc: 100% identical to peptidoglycan DD-carboxypeptidase/peptidoglycan DD-endopeptidase (Escherichia coli K-12 substr. MG1655)
Serine-type D-Ala-D-Ala carboxypeptidase. [EC: 3.4.16.4]; 3.4.-.- [EC: 3.4.16.4]

Predicted SEED Role

"Penicillin-binding protein AmpH"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>MCAODC_27890 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH (Escherichia coli ECRC101)
LKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQ
RVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGA
RVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQ
AAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMD
VPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRF
KNMSDGINDLVTELSGNKPLVIPAS