Protein Info for MCAODC_27870 in Escherichia coli ECRC101

Name: yaiY
Annotation: Inner membrane protein YaiY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 68 to 96 (29 residues), see Phobius details PF10954: DUF2755" amino acids 1 to 101 (101 residues), 165.6 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 100% identical to YAIY_ECOLI: Inner membrane protein YaiY (yaiY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0379)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>MCAODC_27870 Inner membrane protein YaiY (Escherichia coli ECRC101)
MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQE
TGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ