Protein Info for MCAODC_27360 in Escherichia coli ECRC101

Name: aes
Annotation: acetyl esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10340: Say1_Mug180
  • amino acids 77 to 235 (159 residues), 30.7 bits, E=2.4e-11
• PF20434: BD-FAE
  • amino acids 86 to 205 (120 residues), 61.4 bits, E=1.5e-20
• PF07859: Abhydrolase_3
  • amino acids 87 to 295 (209 residues), 192.6 bits, E=1.1e-60

Best Hits

Swiss-Prot: 100% identical to AES_ECO5E: Acetyl esterase (aes) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K01066, esterase / lipase [EC: 3.1.1.-] (inferred from 99% identity to eco:b0476)

MetaCyc: 99% identical to acetylesterase (Escherichia coli K-12 substr. MG1655)
Acetylesterase. [EC: 3.1.1.6]

Predicted SEED Role

"Acetyl esterase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Ascorbate and aldarate metabolism
• Glycerophospholipid metabolism
• Retinol metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.- or 3.1.1.6

Protein Sequence (319 amino acids)

>MCAODC_27360 acetyl esterase (Escherichia coli ECRC101)
MKPENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMAT
KAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIG
IDYTLSPEARFPQVIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRD
KQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYY
CLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRM
MKTADEALRDGAQFFTAQL