Protein Info for MCAODC_26920 in Escherichia coli ECRC101

Name: cusR
Annotation: copper response regulator transcription factor CusR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR01387: heavy metal response regulator" amino acids 3 to 221 (219 residues), 323.7 bits, see alignment E=2.8e-101 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 96.2 bits, see alignment E=1.4e-31 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 91.8 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 100% identical to CUSR_ECOLI: Transcriptional regulatory protein CusR (cusR) from Escherichia coli (strain K12)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 100% identity to eco:b0571)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>MCAODC_26920 copper response regulator transcription factor CusR (Escherichia coli ECRC101)
MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGW
DIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGA
AVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVW
DMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEVPDGQ