Protein Info for MCAODC_26625 in Escherichia coli ECRC101

Name: tatE
Annotation: deaminated glutathione amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 3 to 245 (243 residues), 140.3 bits, E=3.8e-45

Best Hits

Swiss-Prot: 100% identical to YBEM_ECO57: Deaminated glutathione amidase (ybeM) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to sfv:SFV_0700)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

• acrylonitrile degradation I (1/2 steps found)
• indole-3-acetate biosynthesis III (bacteria) (1/2 steps found)
• indole-3-acetate biosynthesis IV (bacteria) (1/2 steps found)
• L-arginine degradation X (arginine monooxygenase pathway) (1/3 steps found)
• superpathway of acrylonitrile degradation (1/3 steps found)
• indole-3-acetate biosynthesis II (3/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Cyanoamino acid metabolism
• Phenylalanine metabolism
• Styrene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.4

Use Curated BLAST to search for 3.5.1.4

Protein Sequence (262 amino acids)

>MCAODC_26625 deaminated glutathione amidase (Escherichia coli ECRC101)
MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLARDDHDADLSVKSAQLL
EGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNIVARYAKLHLYDAFAIQ
ESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQGAEILVLPAAWVRGPLKE
HHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPER
VRQVRAQLPVLNNRRFAPPQLL