Protein Info for MCAODC_26535 in Escherichia coli ECRC101

Name: ybeQ
Annotation: Sel1-repeat-containing protein YbeQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF08238: Sel1" amino acids 2 to 37 (36 residues), 39.7 bits, see alignment 2.4e-14 amino acids 38 to 73 (36 residues), 38.3 bits, see alignment 6.6e-14 amino acids 75 to 109 (35 residues), 32.7 bits, see alignment 4e-12 amino acids 112 to 145 (34 residues), 43.5 bits, see alignment 1.5e-15 amino acids 150 to 175 (26 residues), 22.2 bits, see alignment (E = 8.5e-09)

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 100% identity to ece:Z0791)

Predicted SEED Role

"FIG00639187: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>MCAODC_26535 Sel1-repeat-containing protein YbeQ (Escherichia coli ECRC101)
MSYAQNNLGWMYRNGNGAAQDYTLAFFWYKQAALQGHSDAQNNLADLYEDGKGVAQNETL
AAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQDYKQAMYWYLKAAAQGSVGAYVNIGYMY
KHGQGVEKDYQAAFEWFTKAAECNDATAWYNLAIMYHYGEGRPVDLRQALDLYRKVQSSG
TRDVSQEIRETEDLL