Protein Info for MCAODC_26190 in Escherichia coli ECRC101

Annotation: Fimbrial biogenesis outer membrane usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13954: PapC_N" amino acids 23 to 162 (140 residues), 119.5 bits, see alignment E=1.8e-38 PF00577: Usher" amino acids 180 to 729 (550 residues), 606.9 bits, see alignment E=6.5e-186 PF13953: PapC_C" amino acids 743 to 800 (58 residues), 51.1 bits, see alignment 1.5e-17

Best Hits

Swiss-Prot: 83% identical to YBGQ_ECOLI: Uncharacterized outer membrane usher protein YbgQ (ybgQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_0760)

Predicted SEED Role

"Uncharacterized outer membrane usher protein yqiG precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (816 amino acids)

>MCAODC_26190 Fimbrial biogenesis outer membrane usher protein (Escherichia coli ECRC101)
VNIYRLSVLSCLAMVTPPALTAEFNLNVLDKSIRDSVDISLLNQKGVVAPGDYFVSVTVN
NNKISNGQQIRWQKSGDKIIPCINESLIELFGLKSDFRKKLPAIKECVDFSVFPEIIFTF
DQANQQLNITIPQAWLAWHSENWTPPSTWNNGIPGFLMDYNLFASTYRPQSGSSSNNLNA
YGTTGLNAGAWRLRSDYQLSQSDSGDNREQSGAISRTYLFRPLPQIGSRLTLGETDFSSN
IFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVTISHSGRVIYQKKVPPGPFI
IDDLNQSVQGTLDVKVSEEDGRVNNFQVSAASTPFLTRQGQVRYKLAAGRPRSSMSHHTE
DETFISHEVSWGMLSNTSLYGGMLLAGDDYRSGALGIGQNMLWMGALSFDVTWADSHFDT
QQDEQGYSYRFNYSKQVDATNSTISLAAYRFSDRHFHSYANYIDHKYNDADAQDEKQTIS
LSFGQPITLLNLNLYANILHQSWWNADTSTTANITVGFNVDIGDWKDISVSTSFNTTHYE
DKDRDNQIYFSISLPIGESGRLGYDMQNNSNTTTHRMSWNDTLDERNSWGMSAGIQSDRP
DNGAQVSGNYQHLSSAGEWDLTGTYAANDYTSASASWSGSFTATQHGAAFHRRSSTNEPR
LMVSTDGVGDIPIQGNIDYTNRFGIAVVPFVSSYQPTTVAVNMNDLPDGVTVSENVVKET
WTEGAIGFKSLASRAGKDLNVIISDANGHFPPLGADVRQAEGGVSVGMVGENGHAWLSGV
DENQQFTVHWGDQKTCAIHLPEHLEDVTKRLILPCH