Protein Info for MCAODC_26115 in Escherichia coli ECRC101

Name: ttdA
Annotation: class I fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05681: Fumerase
  • amino acids 50 to 325 (276 residues), 250.2 bits, E=2.5e-78
• TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type
  • amino acids 74 to 324 (251 residues), 100.9 bits, E=7.2e-33
• PF05683: Fumerase_C
  • amino acids 331 to 536 (206 residues), 261.9 bits, E=3.2e-82
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 372 to 535 (164 residues), 179.7 bits, E=4.7e-57

Best Hits

Swiss-Prot: 68% identical to FUMA_ECOLI: Fumarate hydratase class I, aerobic (fumA) from Escherichia coli (strain K12)

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 100% identity to ecs:ECs0757)

MetaCyc: 68% identical to fumarase A (Escherichia coli K-12 substr. MG1655)
Oxaloacetate tautomerase. [EC: 5.3.2.2]; Fumarate hydratase. [EC: 5.3.2.2, 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class I (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• mixed acid fermentation (16/16 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• L-glutamate degradation VIII (to propanoate) (7/11 steps found)
• methylaspartate cycle (11/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2 or 5.3.2.2

Protein Sequence (550 amino acids)

>MCAODC_26115 class I fumarate hydratase (Escherichia coli ECRC101)
MSKPFIWQEPFLQNKDGTEYTLISDQHITVTELDGEEVIKIAPEALTLLARQAFYEASFF
LRSAHLQQVASILNDQQASSNDKYVALQLLRNAEVSAKGVLPNCQDTGTATIVASKGQQI
WTGGNDAEALSKGIYSTFQENNLRFSQNAPLDMYTEVNTQTNLPAQIDISAVAGDEYHFL
CVNKGGGSANKAALYQETKSLLQPEKLTAFLIEKMKSLGTAACPPYHIAFVVGGLSADQT
LKIAKLASTKYYDNLPTSGNEQGQAFRDIELEKVLLEASQQFGIGAQFGGKYFAHDIRVI
RLPRHGGSCPIAMALSCSADRNIKAKINKHGIWLEKLEHNPGQYIPASLREENHAQHVQL
DLNRPLRDVMQDLARLPVGTRVSLSGPIVVARDIAHAKIKARLDSGEPMPEYLKHHIVYY
AGPAKTPENMACGSLGPTTGGRMDGYIDTFQAAGGSLVMLSKGNRSQQVTDACHKHGGFN
LGSIGGAAALLAQEYVKSLRCLEYPELGMEAVWMMEVENLPAFILVDDKGNNFFSQFEQQ
HRCASCPAGH