Protein Info for MCAODC_26015 in Escherichia coli ECRC101

Name: cpoB
Annotation: cell division protein CpoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 37 to 110 (74 residues), 76.5 bits, see alignment E=3.8e-25 TIGR02795: tol-pal system protein YbgF" amino acids 144 to 260 (117 residues), 135.2 bits, see alignment E=8.2e-44 PF13174: TPR_6" amino acids 148 to 176 (29 residues), 19 bits, see alignment (E = 5.2e-07) amino acids 182 to 213 (32 residues), 26.1 bits, see alignment 2.8e-09 amino acids 218 to 249 (32 residues), 31 bits, see alignment 7.7e-11 PF13432: TPR_16" amino acids 162 to 214 (53 residues), 27.6 bits, see alignment E=1e-09 amino acids 197 to 249 (53 residues), 20.2 bits, see alignment E=2.2e-07

Best Hits

Swiss-Prot: 99% identical to CPOB_ECOLI: Cell division coordinator CpoB (cpoB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0742)

MetaCyc: 99% identical to cell division coordinator CpoB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>MCAODC_26015 cell division protein CpoB (Escherichia coli ECRC101)
MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVIQLERISNAHSQLLTQLQ
QQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSGGAAAQSTSGDQSGAAA
STTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAMVAFQNFIKNYPDSTYLP
NANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFKVGVIMQDKGDTAKAKAVY
QQVISKYPGTDGAKQAQKRLNAM