Protein Info for MCAODC_25245 in Escherichia coli ECRC101

Name: ybjG
Annotation: undecaprenyl-diphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details PF14378: PAP2_3" amino acids 13 to 160 (148 residues), 27.1 bits, see alignment E=3.5e-10 PF01569: PAP2" amino acids 58 to 162 (105 residues), 54.4 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 98% identical to YBJG_ECOLI: Putative undecaprenyl-diphosphatase YbjG (ybjG) from Escherichia coli (strain K12)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 98% identity to ebr:ECB_00808)

MetaCyc: 98% identical to undecaprenyl pyrophosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Undecaprenyl-diphosphatase. [EC: 3.6.1.27]

Predicted SEED Role

"Putative permease"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>MCAODC_25245 undecaprenyl-diphosphate phosphatase (Escherichia coli ECRC101)
MLENLNLSLFSLINATPDSAPWMISLAIFIAKDLITVVPLLAAVLWLWGLTAQRQLVIKI
AIALAVSLLVSWTMGHLFPHDRPFVENIGYNFLHHAADDSFPSDHGTVIFTFALAFLCWH
RLWSGSLLMVLAVVIAWSRVYLGVHWPLDMLGGLLAGMIGCLSAQIIWQAMGHKLYQRLQ
SWYRFCFALPIRKGWVRD