Protein Info for MCAODC_24925 in Escherichia coli ECRC101

Name: dmsC
Annotation: dimethyl sulfoxide reductase anchor subunit DmsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details PF04976: DmsC" amino acids 1 to 277 (277 residues), 417.6 bits, see alignment E=1.2e-129

Best Hits

Swiss-Prot: 99% identical to DMSC_ECOLI: Anaerobic dimethyl sulfoxide reductase chain C (dmsC) from Escherichia coli (strain K12)

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 99% identity to eco:b0896)

MetaCyc: 99% identical to dimethyl sulfoxide reductase subunit C (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MCAODC_24925 dimethyl sulfoxide reductase anchor subunit DmsC (Escherichia coli ECRC101)
MGSGWHEWPLMIFTVFGQCVAGGFIVLALALLKGDLRAEAQQRVIACMFGLWVLMGIGFI
ASMLHLGSPMRAFNSLNRVGASALSNEIASGSIFFAVGGIGWLLAMLKKLSPALRTLWLV
VTMVLGVVFVWMMVRVYNSIDTVPTWYSIWTPMGFFLTMFMGGPLLGYLLLSLAGVDGWA
MRLLPAISVLALVVSGVMSVMQGTELATIHSSVQQAAALVPDYGALMSWRIVLLAVALCL
WIAPQLKGYQPAVPLLSVSFILLLAGELIGRGVFYGLHMTVGMAVAS