Protein Info for MCAODC_24185 in Escherichia coli ECRC101
Name: hyaC
Annotation: Ni/Fe-hydrogenase b-type cytochrome subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CYBH_ECO57: Probable Ni/Fe-hydrogenase 1 B-type cytochrome subunit (hyaC) from Escherichia coli O157:H7
KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 100% identity to eco:b0974)MetaCyc: 100% identical to hydrogenase 1 cytochrome b subunit (Escherichia coli K-12 substr. MG1655)
1.12.98.-; Hydrogen:quinone oxidoreductase. [EC: 1.12.5.1]
Predicted SEED Role
"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase
MetaCyc Pathways
- hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)
- hydrogen to fumarate electron transfer (1/2 steps found)
- hydrogen to trimethylamine N-oxide electron transfer (1/2 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.12.5.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (235 amino acids)
>MCAODC_24185 Ni/Fe-hydrogenase b-type cytochrome subunit (Escherichia coli ECRC101) MQQKSDNVVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIR LIHFSAGMVFTVVLLMRIYWAFVGNRYSRELFIVPVWRKSWWQGVWYEIRWYLFLAKRPS ADIGHNPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFYWTGGNSMDI HSWHRLGMWLIGAFVIGHVYMALREDIMSDDTVISTMVNGYRSHKFGKISNKERS