Protein Info for MCAODC_24120 in Escherichia coli ECRC101

Annotation: Threonine-rich inner membrane protein GfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details

Best Hits

Swiss-Prot: 98% identical to GFCA_ECOLI: Threonine-rich inner membrane protein GfcA (gfcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b0987)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>MCAODC_24120 Threonine-rich inner membrane protein GfcA (Escherichia coli ECRC101)
MKHKLSAILMAFMLTTPAAFAAPEAANGTEATTGTTGTTTTTTGATTTAATTGGVAAGAV
GTATVVGVATAVGVATLAVVAANDSGDGGSHNTSTTTSTTR