Protein Info for MCAODC_23955 in Escherichia coli ECRC101

Name: efeB
Annotation: iron uptake transporter deferrochelatase/peroxidase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01412: Tat-translocated enzyme
  • amino acids 6 to 422 (417 residues), 617.1 bits, E=1.5e-189
• PF04261: Dyp_perox_N
  • amino acids 61 to 213 (153 residues), 164 bits, E=2.4e-52
• TIGR01413: Dyp-type peroxidase family
  • amino acids 61 to 410 (350 residues), 359.1 bits, E=2.4e-111
• PF20628: Dyp_perox_C
  • amino acids 226 to 410 (185 residues), 187 bits, E=2.4e-59

Best Hits

Swiss-Prot: 100% identical to EFEB_ECO57: Deferrochelatase/peroxidase EfeB (efeB) from Escherichia coli O157:H7

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 99% identity to eco:b1019)

MetaCyc: 99% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (4/4 steps found)
• heme b biosynthesis V (aerobic) (4/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Protein Sequence (423 amino acids)

>MCAODC_23955 iron uptake transporter deferrochelatase/peroxidase subunit (Escherichia coli ECRC101)
MQYEDKNGVNEPSRRRLLKGIGALALAGSCPVAHAQKTQSAPGTLSPVARNEKQPFYGEH
QAGILTPQQAAMMLVAFDVLASDKADLERLFRLLTQRFAFLTQGGAAPETPNPRLPPLDS
GILGGYIAPDNLTITLSVGHSLFDERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQ
ICANTQDTVIHALRDIIKHTPDLLSVRWKREGFISDHAARSKGKETPINLLGFKDGTANP
DSQNDKLMQKVVWVTADQQEPAWTIGGSYQAVRLIQFRVEFWDRTPLKEQQTIFGRDKQT
GAPLGMQHEHDVPDYASDPEGKGIALDSHIRLANPRTAESESSLMLRRGYSYSLGVTNSG
QLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEEYVKPIGGGYFFALPGVKDANDYLGSAL
LRV